KEGG   Physeter macrocephalus (sperm whale): 102992439
Entry
102992439         CDS       T06011                                 
Name
(RefSeq) LOW QUALITY PROTEIN: GTPase NRas-like
  KO
K07828  GTPase NRas
Organism
pcad  Physeter macrocephalus (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04625  C-type lectin receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05034  Alcoholism
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05207  Chemical carcinogenesis - receptor activation
pcad05208  Chemical carcinogenesis - reactive oxygen species
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102992439
   04012 ErbB signaling pathway
    102992439
   04014 Ras signaling pathway
    102992439
   04015 Rap1 signaling pathway
    102992439
   04370 VEGF signaling pathway
    102992439
   04371 Apelin signaling pathway
    102992439
   04068 FoxO signaling pathway
    102992439
   04072 Phospholipase D signaling pathway
    102992439
   04071 Sphingolipid signaling pathway
    102992439
   04151 PI3K-Akt signaling pathway
    102992439
   04150 mTOR signaling pathway
    102992439
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102992439
   04137 Mitophagy - animal
    102992439
  09143 Cell growth and death
   04210 Apoptosis
    102992439
   04218 Cellular senescence
    102992439
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102992439
   04550 Signaling pathways regulating pluripotency of stem cells
    102992439
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102992439
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102992439
   04650 Natural killer cell mediated cytotoxicity
    102992439
   04660 T cell receptor signaling pathway
    102992439
   04662 B cell receptor signaling pathway
    102992439
   04664 Fc epsilon RI signaling pathway
    102992439
   04062 Chemokine signaling pathway
    102992439
  09152 Endocrine system
   04910 Insulin signaling pathway
    102992439
   04929 GnRH secretion
    102992439
   04912 GnRH signaling pathway
    102992439
   04915 Estrogen signaling pathway
    102992439
   04917 Prolactin signaling pathway
    102992439
   04921 Oxytocin signaling pathway
    102992439
   04926 Relaxin signaling pathway
    102992439
   04935 Growth hormone synthesis, secretion and action
    102992439
   04919 Thyroid hormone signaling pathway
    102992439
   04916 Melanogenesis
    102992439
  09156 Nervous system
   04725 Cholinergic synapse
    102992439
   04726 Serotonergic synapse
    102992439
   04720 Long-term potentiation
    102992439
   04730 Long-term depression
    102992439
   04722 Neurotrophin signaling pathway
    102992439
  09158 Development and regeneration
   04360 Axon guidance
    102992439
  09149 Aging
   04211 Longevity regulating pathway
    102992439
   04213 Longevity regulating pathway - multiple species
    102992439
  09159 Environmental adaptation
   04714 Thermogenesis
    102992439
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992439
   05206 MicroRNAs in cancer
    102992439
   05205 Proteoglycans in cancer
    102992439
   05207 Chemical carcinogenesis - receptor activation
    102992439
   05208 Chemical carcinogenesis - reactive oxygen species
    102992439
   05203 Viral carcinogenesis
    102992439
   05230 Central carbon metabolism in cancer
    102992439
   05231 Choline metabolism in cancer
    102992439
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102992439
  09162 Cancer: specific types
   05210 Colorectal cancer
    102992439
   05225 Hepatocellular carcinoma
    102992439
   05226 Gastric cancer
    102992439
   05214 Glioma
    102992439
   05216 Thyroid cancer
    102992439
   05221 Acute myeloid leukemia
    102992439
   05220 Chronic myeloid leukemia
    102992439
   05218 Melanoma
    102992439
   05211 Renal cell carcinoma
    102992439
   05219 Bladder cancer
    102992439
   05215 Prostate cancer
    102992439
   05213 Endometrial cancer
    102992439
   05224 Breast cancer
    102992439
   05223 Non-small cell lung cancer
    102992439
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102992439
   05170 Human immunodeficiency virus 1 infection
    102992439
   05161 Hepatitis B
    102992439
   05160 Hepatitis C
    102992439
   05163 Human cytomegalovirus infection
    102992439
   05167 Kaposi sarcoma-associated herpesvirus infection
    102992439
   05165 Human papillomavirus infection
    102992439
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102992439
   05022 Pathways of neurodegeneration - multiple diseases
    102992439
  09165 Substance dependence
   05034 Alcoholism
    102992439
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102992439
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102992439
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102992439
   01522 Endocrine resistance
    102992439
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102992439
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102992439
   04031 GTP-binding proteins [BR:pcad04031]
    102992439
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102992439
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102992439
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102992439
  Exosomal proteins of other body fluids (saliva and urine)
   102992439
  Exosomal proteins of breast cancer cells
   102992439
  Exosomal proteins of colorectal cancer cells
   102992439
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102992439
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin CbiA
Other DBs
NCBI-GeneID: 102992439
NCBI-ProteinID: XP_028351280
UniProt: A0A455BQM5
LinkDB
Position
11:60355806..60356896
AA seq 189 aa
MTEYKLVVVGSGGVGKSALTIQLIQNHFVDEYDPTIEDSYQKQVVIDGETCLLDILDTAG
QEEYSAMXDXYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggatcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatacgatcccaccatagaggattcttac
caaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgtgagactaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccagcaaggacagttgacacaaaacaagcccatgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system