Physeter macrocephalus (sperm whale): 102992710
Help
Entry
102992710 CDS
T06011
Symbol
SOCS1
Name
(RefSeq) suppressor of cytokine signaling 1
KO
K04694
suppressor of cytokine signaling 1
Organism
pcad
Physeter macrocephalus (sperm whale)
Pathway
pcad04120
Ubiquitin mediated proteolysis
pcad04380
Osteoclast differentiation
pcad04630
JAK-STAT signaling pathway
pcad04910
Insulin signaling pathway
pcad04917
Prolactin signaling pathway
pcad04930
Type II diabetes mellitus
pcad04935
Growth hormone synthesis, secretion and action
pcad05145
Toxoplasmosis
pcad05206
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:
pcad00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04120 Ubiquitin mediated proteolysis
102992710 (SOCS1)
09130 Environmental Information Processing
09132 Signal transduction
04630 JAK-STAT signaling pathway
102992710 (SOCS1)
09150 Organismal Systems
09152 Endocrine system
04910 Insulin signaling pathway
102992710 (SOCS1)
04917 Prolactin signaling pathway
102992710 (SOCS1)
04935 Growth hormone synthesis, secretion and action
102992710 (SOCS1)
09158 Development and regeneration
04380 Osteoclast differentiation
102992710 (SOCS1)
09160 Human Diseases
09161 Cancer: overview
05206 MicroRNAs in cancer
102992710 (SOCS1)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
102992710 (SOCS1)
09167 Endocrine and metabolic disease
04930 Type II diabetes mellitus
102992710 (SOCS1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:
pcad04121
]
102992710 (SOCS1)
Ubiquitin system [BR:
pcad04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
Cul5 complex
Target recognizing subunit
102992710 (SOCS1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SH2
SOCS_box
SH2_1
Motif
Other DBs
NCBI-GeneID:
102992710
NCBI-ProteinID:
XP_007101694
Ensembl:
ENSPCTG00005010255
UniProt:
A0A2Y9EHG6
LinkDB
All DBs
Position
14:complement(55008491..55010255)
Genome browser
AA seq
215 aa
AA seq
DB search
MVAHNQVAADNAISTAAEPRRRPEPSSSSSSSSSSSPAVPARPRPCPAAPASTPGDTHFR
TFRSHAEYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALS
VKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPPRMLGAPLRQRRVRPLQE
LCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq
648 nt
NT seq
+upstream
nt +downstream
nt
atggtagcacacaaccaggtggcagccgacaatgcaatctccacggcagcagagccccga
cggcggccagagccttcctcctcctcctcctcttcttcctcctcctcgcccgcggtcccg
gcgcgtccgcggccctgcccggctgctccggcttcgaccccgggcgacacgcacttccgc
acgttccgctcgcacgccgagtaccggcgcatcacccgggccagcgcgctcctggacgcc
tgcggcttctactggggacccctgagcgtgcacggggcgcacgagcggctgcgcgcagag
cccgtgggcacctttctggtgcgcgacagccgccagcggaactgcttcttcgccctcagc
gtgaagatggcctcgggccccacgagcatccgcgtgcacttccaggccggccgcttccac
ctggacggcagccgcgagagcttcgactgcctcttcgagctgctggaacactacgtggcg
gcgccgccccgcatgctgggggccccgctgcgccagcgccgcgtgcggccacttcaggag
ctgtgccgccagcgcattgtggccaccgtgggccgcgagaacctggcgcgcatccccctc
aaccccgtcctccgggactacttgagctccttccccttccagatctga
DBGET
integrated database retrieval system