Physeter macrocephalus (sperm whale): 102992954 Help Entry 102992954         CDS       T06011                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway pcad04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102992954 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     102992954 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102992954 (CCL22)    04062 Chemokine signaling pathway     102992954 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102992954 (CCL22) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102992954 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102992954 NCBI-ProteinID:  XP_007129642 Ensembl:  ENSPCTG00005017906 UniProt:  A0A2Y9FSB4 LinkDB All DBs Position 17:complement(28824399..28828251) Genome browser AA seq 93 aa AA seqDB search MASLQTPLLAALILLAMILQATEAGPYGANVEDSICCRDYIRYALPLRLVKYYYWTSDSC RRPGVVLLTVRDREICADPRLPWVKKVLQRLDQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcagaccccactcctggctgccctcattctccttgctatgatacttcaa gcaacagaggcaggcccctacggtgccaacgtggaggacagcatctgctgccgggactac atccgttacgccctgcccctgcgtctggtgaaatattactactggacttcggactcctgc cggaggcctggcgtggtcttgctaaccgtgagggaccgagagatctgtgctgatcccaga ctgccctgggtgaagaaagttctccagaggctggaccaatga

DBGET integrated database retrieval system