Physeter macrocephalus (sperm whale): 102993323 Help Entry 102993323         CDS       T06011                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04810   Regulation of actin cytoskeleton pcad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcad00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102993323  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102993323 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd MerR-DNA-bind Motif Other DBs NCBI-GeneID:  102993323 NCBI-ProteinID:  XP_054935199 UniProt:  A0A9W2W7J6 LinkDB All DBs Position 17:complement(42032635..42032853) Genome browser AA seq 65 aa AA seqDB search MVGQEDPVQREIHQDWANWEYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALEQR IESTE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggtgggacaagaggatccagtgcagcgggagattcaccaggactgggcgaactgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcagactttctcaactcgtttgat atgtcttgtcgttcaagactcgcaacactaaacgagaaactgacagctcttgaacagaga atagagtccactgaatga

DBGET integrated database retrieval system