Physeter macrocephalus (sperm whale): 102993527 Help Entry 102993527         CDS       T06011                                  Symbol ELOC Name (RefSeq) elongin-C isoform X1   KO K03872   elongin-C Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04066   HIF-1 signaling pathway pcad04120   Ubiquitin mediated proteolysis pcad05170   Human immunodeficiency virus 1 infection pcad05200   Pathways in cancer pcad05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102993527 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102993527 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102993527 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     102993527 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102993527 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pcad04121]     102993527 (ELOC)    03400 DNA repair and recombination proteins [BR:pcad03400]     102993527 (ELOC) Ubiquitin system [BR:pcad04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      102993527 (ELOC)    Cul5 complex      102993527 (ELOC) DNA repair and recombination proteins [BR:pcad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102993527 (ELOC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  102993527 NCBI-ProteinID:  XP_007116509 Ensembl:  ENSPCTG00005011391 UniProt:  A0A2Y9F8S7 LinkDB All DBs Position 15:62763815..62782616 Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacctatggtggctgtgagggccctgacgccatgtatgtcaaa ttgatatcttcggatggtcatgaatttattgtaaaaagagaacatgcgctaacatcagga acaataaaagccatgttgagtggcccaggtcaatttgctgagaacgaaactaatgaagtc aattttagagagatcccttcacatgtgctatcaaaagtatgcatgtattttacctacaag gttcgctacactaacagctccacggagattcctgaatttccaattgcacctgaaattgca ctggaactgctgatggctgcaaacttcctagattgttaa

DBGET integrated database retrieval system