Physeter catodon (sperm whale): 102994517 Help Entry 102994517         CDS       T06011                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism pcad  Physeter catodon (sperm whale) Pathway pcad04072   Phospholipase D signaling pathway pcad04140   Autophagy - animal pcad04150   mTOR signaling pathway pcad04151   PI3K-Akt signaling pathway pcad04152   AMPK signaling pathway pcad04211   Longevity regulating pathway pcad04218   Cellular senescence pcad04714   Thermogenesis pcad04910   Insulin signaling pathway pcad04919   Thyroid hormone signaling pathway pcad05163   Human cytomegalovirus infection pcad05165   Human papillomavirus infection pcad05168   Herpes simplex virus 1 infection pcad05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     102994517 (RHEB)    04151 PI3K-Akt signaling pathway     102994517 (RHEB)    04152 AMPK signaling pathway     102994517 (RHEB)    04150 mTOR signaling pathway     102994517 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102994517 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     102994517 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102994517 (RHEB)    04919 Thyroid hormone signaling pathway     102994517 (RHEB)   09149 Aging    04211 Longevity regulating pathway     102994517 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     102994517 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     102994517 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102994517 (RHEB)    05163 Human cytomegalovirus infection     102994517 (RHEB)    05165 Human papillomavirus infection     102994517 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pcad04031]     102994517 (RHEB) GTP-binding proteins [BR:pcad04031]  Small (monomeric) G-proteins   Ras Family    Rheb     102994517 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 Motif Other DBs NCBI-GeneID:  102994517 NCBI-ProteinID:  XP_028345374 UniProt:  A0A455B9N3 LinkDB All DBs Position 5:5916101..5968390 Genome browser AA seq 188 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQPCRCSFKGIFEEGCHFYFRRLPVSPF PFSSMALI NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccaatttgttgattcctacgatccaaccatagaa aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcaacttgtagat acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagctttgaagtgatcaaagttatccat ggcaaactgttggatatggtggggaaagtacagatacctattatgttggttgggaataag aaggacctgcatatggaaagggtgatcagttatgaagaagggaaagcgttagcagaatct tggaacgcagcttttttggaatcttctgctaaagaaaatcagccctgcagatgttccttt aaaggcatattcgaggaaggatgtcacttctatttcagaaggcttcccgtatctcctttt cccttttcctccatggcgttaatttag

DBGET integrated database retrieval system