Physeter macrocephalus (sperm whale): 102994614 Help Entry 102994614         CDS       T06011                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04814   Motor proteins pcad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcad00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102994614 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102994614 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcad03037]     102994614 (DYNLT3)    04812 Cytoskeleton proteins [BR:pcad04812]     102994614 (DYNLT3) Cilium and associated proteins [BR:pcad03037]  Motile cilia and associated proteins   Dynein arm    102994614 (DYNLT3) Cytoskeleton proteins [BR:pcad04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102994614 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  102994614 NCBI-ProteinID:  XP_023972247 Ensembl:  ENSPCTG00005018153 UniProt:  A0A2Y9S4E1 LinkDB All DBs Position 21:complement(21017338..21028879) Genome browser AA seq 116 aa AA seqDB search MEEYHRPCDEVGFNADEAHNIVKECIDGVLGGEDYNHSNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgcccctgcgacgaggtcggcttcaatgctgatgaagcccacaat atcgttaaagagtgtatagatggggtcttgggaggtgaagattataatcatagcaacatc aaccaatggactgcaagcatagtggaacaatccttagcacatctggttaagttgggaaaa gcttataagtatattgtgacctgtgcggtggtccagaggagtgcatatggctttcacaca gccagctcatgtttttgggacaccacatctgatggaacctgtactgtaagatgggaaaac cgaaccatgaactgtattgtcaatgtctttgccattgctattgtcctgtaa

DBGET integrated database retrieval system