KEGG   Physeter macrocephalus (sperm whale): 102994715
Entry
102994715         CDS       T06011                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X2
  KO
K02833  GTPase HRas
Organism
pcad  Physeter macrocephalus (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04137  Mitophagy - animal
pcad04140  Autophagy - animal
pcad04144  Endocytosis
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04720  Long-term potentiation
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05034  Alcoholism
pcad05132  Salmonella infection
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05207  Chemical carcinogenesis - receptor activation
pcad05208  Chemical carcinogenesis - reactive oxygen species
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102994715 (HRAS)
   04012 ErbB signaling pathway
    102994715 (HRAS)
   04014 Ras signaling pathway
    102994715 (HRAS)
   04015 Rap1 signaling pathway
    102994715 (HRAS)
   04370 VEGF signaling pathway
    102994715 (HRAS)
   04371 Apelin signaling pathway
    102994715 (HRAS)
   04630 JAK-STAT signaling pathway
    102994715 (HRAS)
   04068 FoxO signaling pathway
    102994715 (HRAS)
   04072 Phospholipase D signaling pathway
    102994715 (HRAS)
   04071 Sphingolipid signaling pathway
    102994715 (HRAS)
   04151 PI3K-Akt signaling pathway
    102994715 (HRAS)
   04150 mTOR signaling pathway
    102994715 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102994715 (HRAS)
   04140 Autophagy - animal
    102994715 (HRAS)
   04137 Mitophagy - animal
    102994715 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102994715 (HRAS)
   04218 Cellular senescence
    102994715 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102994715 (HRAS)
   04540 Gap junction
    102994715 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102994715 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102994715 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102994715 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    102994715 (HRAS)
   04660 T cell receptor signaling pathway
    102994715 (HRAS)
   04662 B cell receptor signaling pathway
    102994715 (HRAS)
   04664 Fc epsilon RI signaling pathway
    102994715 (HRAS)
   04062 Chemokine signaling pathway
    102994715 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102994715 (HRAS)
   04929 GnRH secretion
    102994715 (HRAS)
   04912 GnRH signaling pathway
    102994715 (HRAS)
   04915 Estrogen signaling pathway
    102994715 (HRAS)
   04917 Prolactin signaling pathway
    102994715 (HRAS)
   04921 Oxytocin signaling pathway
    102994715 (HRAS)
   04926 Relaxin signaling pathway
    102994715 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    102994715 (HRAS)
   04919 Thyroid hormone signaling pathway
    102994715 (HRAS)
   04916 Melanogenesis
    102994715 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102994715 (HRAS)
   04726 Serotonergic synapse
    102994715 (HRAS)
   04720 Long-term potentiation
    102994715 (HRAS)
   04730 Long-term depression
    102994715 (HRAS)
   04722 Neurotrophin signaling pathway
    102994715 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102994715 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102994715 (HRAS)
   04213 Longevity regulating pathway - multiple species
    102994715 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102994715 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102994715 (HRAS)
   05206 MicroRNAs in cancer
    102994715 (HRAS)
   05205 Proteoglycans in cancer
    102994715 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    102994715 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102994715 (HRAS)
   05203 Viral carcinogenesis
    102994715 (HRAS)
   05230 Central carbon metabolism in cancer
    102994715 (HRAS)
   05231 Choline metabolism in cancer
    102994715 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102994715 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102994715 (HRAS)
   05225 Hepatocellular carcinoma
    102994715 (HRAS)
   05226 Gastric cancer
    102994715 (HRAS)
   05214 Glioma
    102994715 (HRAS)
   05216 Thyroid cancer
    102994715 (HRAS)
   05221 Acute myeloid leukemia
    102994715 (HRAS)
   05220 Chronic myeloid leukemia
    102994715 (HRAS)
   05218 Melanoma
    102994715 (HRAS)
   05211 Renal cell carcinoma
    102994715 (HRAS)
   05219 Bladder cancer
    102994715 (HRAS)
   05215 Prostate cancer
    102994715 (HRAS)
   05213 Endometrial cancer
    102994715 (HRAS)
   05224 Breast cancer
    102994715 (HRAS)
   05223 Non-small cell lung cancer
    102994715 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102994715 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    102994715 (HRAS)
   05161 Hepatitis B
    102994715 (HRAS)
   05160 Hepatitis C
    102994715 (HRAS)
   05163 Human cytomegalovirus infection
    102994715 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102994715 (HRAS)
   05165 Human papillomavirus infection
    102994715 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102994715 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102994715 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102994715 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    102994715 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102994715 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102994715 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102994715 (HRAS)
   01522 Endocrine resistance
    102994715 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102994715 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102994715 (HRAS)
   04031 GTP-binding proteins [BR:pcad04031]
    102994715 (HRAS)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102994715 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102994715 (HRAS)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102994715 (HRAS)
  Exosomal proteins of colorectal cancer cells
   102994715 (HRAS)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102994715 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin AAA_22 Ldh_1_N AAA_16
Other DBs
NCBI-GeneID: 102994715
NCBI-ProteinID: XP_007108716
Ensembl: ENSPCTG00005018089
UniProt: A0A2Y9EVH5
LinkDB
Position
18:4471539..4476163
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG
CLSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgctggaggcgtagggaagagcgccctgacc
atccagctcatccagaaccactttgtggacgagtacgaccccaccatagaggactcctac
cggaagcaagtggtcatcgatggggagacctgcctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt
gtgtttgccatcaacaatgccaagtccttcgaggacatccaccagtacagggagcagatc
aaacgggtgaaggactcggacgatgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc
tatatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctacacgctggtg
cgcgagatccggcagcacaaggcgcgcaagctgagcccgcctgacgagggcggcccgggc
tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system