Physeter macrocephalus (sperm whale): 102996136 Help Entry 102996136         CDS       T06011                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad03008   Ribosome biogenesis in eukaryotes pcad03013   Nucleocytoplasmic transport pcad03015   mRNA surveillance pathway pcad05014   Amyotrophic lateral sclerosis pcad05164   Influenza A Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     102996136 (NXT1)    03015 mRNA surveillance pathway     102996136 (NXT1)    03008 Ribosome biogenesis in eukaryotes     102996136 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102996136 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102996136 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcad03019]     102996136 (NXT1)    03009 Ribosome biogenesis [BR:pcad03009]     102996136 (NXT1) Messenger RNA biogenesis [BR:pcad03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      102996136 (NXT1) Ribosome biogenesis [BR:pcad03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     102996136 (NXT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 NXF_NTF2 Glyco_tran_10_N Cofilin_ADF Motif Other DBs NCBI-GeneID:  102996136 NCBI-ProteinID:  XP_007100571 Ensembl:  ENSPCTG00005022374 UniProt:  A0A2Y9EEV6 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAC NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcgtccgtggacttcaagacctacgtggaccaggcctgccgcgccgctgaggagttc gtgaatgtgtactacaccaccatggacaagagacggcggctgctgtcccgcctgtacatg ggcacggccaccttggtgtggaacggcaatgccgtttcgggacaagagtccttgagtgag ttttttgagatgctgccttccagtgagttccaaatcaacgtggtagactgccagcccgtt catgatgaagccaccccgagccagaccacggtcctcgtggtgatctgtgggacagtgaag tttgagggcaacaaacagcgggacttcaaccagaacttcatcctgacagcccaggcctcg cccagcaacacggtgtggaagattgccagcgactgcttccggttccaggactgggcctgc tag

DBGET integrated database retrieval system