Physeter macrocephalus (sperm whale): 112061949
Help
Entry
112061949 CDS
T06011
Name
(RefSeq) DNA polymerase delta subunit 2-like
KO
K02328
DNA polymerase delta subunit 2
Organism
pcad
Physeter macrocephalus (sperm whale)
Pathway
pcad03030
DNA replication
pcad03410
Base excision repair
pcad03420
Nucleotide excision repair
pcad03430
Mismatch repair
pcad03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
pcad00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
112061949
03410 Base excision repair
112061949
03420 Nucleotide excision repair
112061949
03430 Mismatch repair
112061949
03440 Homologous recombination
112061949
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
pcad03032
]
112061949
03400 DNA repair and recombination proteins [BR:
pcad03400
]
112061949
DNA replication proteins [BR:
pcad03032
]
Eukaryotic type
DNA Replication Elongation Factors
DNA polymerase delta complex
112061949
DNA repair and recombination proteins [BR:
pcad03400
]
Eukaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
Long Patch-BER factors
DNA polymerase delta complex
112061949
MMR (mismatch excision repair)
DNA polymerase delta complex
112061949
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_pol_E_B
DNA_pol_D_N
Motif
Other DBs
NCBI-GeneID:
112061949
NCBI-ProteinID:
XP_023970857
UniProt:
A0A2Y9S037
LinkDB
All DBs
Position
5:complement(99751769..99757014)
Genome browser
AA seq
465 aa
AA seq
DB search
MNGALAGLPSQPQLKHPVLREAAWASRAFSASTAFTPVCSQHLSQRQILPFLLLRLPLRR
KLTHTPCAAGSGVLIKKLFELQPGEKCCVVGTLFKAMLLQPSILREVSEEHNLLPQPPRS
KYIHADDELILEDELQRIKLAGTIDVAKLVTGTVLAVLGSAGDDGKFLVEDHCFAGLAPQ
KPAHPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILA
GNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNY
MLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEI
LEWTLQVRHISPTAPDTLGCYPFYKTDPFIFLECPHVYFCGSTLSFGSKIIRGPEDQTVL
LVAVPDFSATQTACLVNLRSLACQPISFSGFGAEEEDLGGLDLGP
NT seq
1398 nt
NT seq
+upstream
nt +downstream
nt
atgaatggggccttggctgggcttccttcacaacctcaactgaaacatcctgtgcttcga
gaggccgcctgggctagcagggccttctccgcatctactgccttcactcctgtctgttcg
cagcacctgtcccagcggcagatcctgcctttcctgctcttgcgtctccctctgcgccgg
aagctcactcataccccttgtgccgcaggcagtggagtcctaattaagaagctgtttgag
ctgcagcctggggagaagtgctgtgtggtagggaccctcttcaaggccatgctgctccag
ccctccatcctgcgggaggtcagcgaagagcacaacctgctcccccagcctcctcggagc
aaatacatccacgcagatgatgaactgatcttggaagatgaactgcagcgtatcaaactg
gcgggcaccatcgacgtggcaaagctggtcacagggacggtcctggctgtgctgggctct
gcaggagacgacgggaagttcctggtggaggaccactgctttgcagggcttgctcctcag
aagcccgcacaccccctcgacacggacaggtttgtgctgctggtgtccggcctgggcctg
ggtggaggcgggggcgagagcctgctgggcacccagctgctggtggacgtggtgacgggg
cagcttggggatgaaggggagcagtgcagcgccgcccacgtctcccgggtcatcctcgcc
gggaacctcctgagccacaacacccagagcagagattccatcaataaggccaagtactta
accaagaaaacccaggcagccagcgtggaggctgtcaagatgctggacgagatcctcctg
cagctgagcgcatctgtgcccgtggacgtgatgccaggcgaatttgacccaacaaactac
atgctcccccagcagcccctgcacccctgcatgttcccactggccactgcctactccacg
ctccagctggtcaccaacccctaccaggccaccatcgacggagtcagattcctggggacg
tcgggacagaacgtgagtgacatcttccggtacagcagcatggaggaccacttggagatc
ctggagtggaccctgcaagtccgtcacatcagccctacagcccctgacaccctaggttgt
taccctttctataaaaccgacccgttcatctttctggagtgccctcacgtctacttttgt
ggcagcaccctcagctttggctccaaaatcatccgaggccccgaggaccagacagtgttg
ctggtggctgttccggacttcagtgccacacagaccgcctgccttgtgaacctgcgcagc
ctggcatgccagcccatcagcttctcaggcttcggggcagaggaggaggacctgggaggc
ctggatctgggcccctga
DBGET
integrated database retrieval system