Physeter macrocephalus (sperm whale): 112061978 Help Entry 112061978         CDS       T06011                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pcad  Physeter macrocephalus (sperm whale) Brite KEGG Orthology (KO) [BR:pcad00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pcad03041]     112061978   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     112061978 Spliceosome [BR:pcad03041]  Complex B   Other components    Complex B specific factors     112061978 Cytokines and neuropeptides [BR:pcad04052]  Neuropeptides   Unclassified    112061978 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 ULD_2 Motif Other DBs NCBI-GeneID:  112061978 NCBI-ProteinID:  XP_023970977 Ensembl:  ENSPCTG00005002407 UniProt:  A0A2Y9S0G6 LinkDB All DBs Position 1:46870853..46871156 Genome browser AA seq 71 aa AA seqDB search MIEVVCNDHLGRKVRLKCNTDDTIGDLRKLIAAQTGTLWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELY NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccatctggggaggaaggtccgccttaaatgcaatact gatgacaccatcggggaccttaggaagctgattgcagcccaaactggcaccctttggaac aagattgtattgaagaagtggtacacgatttttaaggaccacgtatctctgggtgactat gaaatccacgatgggatgaacctggagctttattag

DBGET integrated database retrieval system