Physeter macrocephalus (sperm whale): 112062576 Help Entry 112062576         CDS       T06011                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05203   Viral carcinogenesis pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112062576  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112062576   09163 Immune disease    05322 Systemic lupus erythematosus     112062576   09165 Substance dependence    05034 Alcoholism     112062576  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     112062576   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     112062576 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112062576 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112062576 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF TFIID_20kDa MCPsignal DUF3536 Motif Other DBs NCBI-GeneID:  112062576 NCBI-ProteinID:  XP_023973078 UniProt:  A0A2Y9S3G2 LinkDB All DBs Position 21:complement(79703258..79703662) Genome browser AA seq 134 aa AA seqDB search MSEPSSVTSEESLGTKEAEPSKAEPEEPKQKAAKRHRRRSDGFDSFATYFPRVLKQVHQG LSLSQEAAKVMDSFVQDIFERIADEAARLVRSSKRSTLSSREIQTSVRLLLPGEMGKHAM SKANKAVIRYTTGK NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgtctgagccttcgtctgtgacgtctgaagaaagcctgggcaccaaggaagccgagccc tccaaagccgagccggaggaaccgaagcagaaggcagcgaagcgccaccgccgccgctct gacggcttcgacagctttgccacctatttccccagggtgctgaagcaggtccaccagggc ctgagcctctcgcaggaggccgcgaaggtcatggattcgttcgttcaggacatctttgag cgaatcgccgacgaggcggcgcgcctggtccgctccagcaagcgctccaccctcagctcc agagagatccagacctccgtgcgcctgctgctgcctggggagatgggcaagcacgccatg tccaaggccaacaaggccgtcatcagatacaccaccggcaaatga

DBGET integrated database retrieval system