Physeter macrocephalus (sperm whale): 112062578 Help Entry 112062578         CDS       T06011                                  Name (RefSeq) histone H2B type W-T-like   KO K11252   histone H2B Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05203   Viral carcinogenesis pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112062578  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112062578   09163 Immune disease    05322 Systemic lupus erythematosus     112062578   09165 Substance dependence    05034 Alcoholism     112062578  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     112062578   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     112062578 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112062578 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112062578 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  112062578 NCBI-ProteinID:  XP_023973080 Ensembl:  ENSPCTG00005007785 UniProt:  A0A2Y9S9U9 LinkDB All DBs Position 21:79673564..79673983 Genome browser AA seq 139 aa AA seqDB search MDIACDIREGRDYKPAHWPSAASSSFPLSCGEVGSDMAEPCRETSSEESLGTKEPTEAEP KSPKQKMPRCCRRCCPDSFITSFPRVLKQVHEGLDIFEPIAEESAPLASSTKRSTITFRE IQTSVPLLLPREIGKHAMS NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggacattgcctgtgacatcagagaaggcagggattataaacccgcccactggccctca gcagcctcatcgtcctttcctctgagctgtggggaagttggctccgacatggccgagccc tgtcgtgagacttcttctgaggaaagcctcggcaccaaagagcccacagaagccgaacca aagagcccaaagcagaagatgccaaggtgttgtcgccgctgctgcccggacagtttcatc acctctttccccagggttctgaagcaggttcacgagggcctggacatcttcgagcccatc gccgaggagtctgcacccctggccagctccaccaagcgctccaccatcaccttcagagag atccagacctccgtgcccctgctgctgcccagggagattggcaagcacgccatgtcctag

DBGET integrated database retrieval system