Physeter catodon (sperm whale): 112064949 Help Entry 112064949         CDS       T06011                                  Name (RefSeq) caveolin-3-like   KO K12959   caveolin 3 Organism pcad  Physeter catodon (sperm whale) Pathway pcad04144   Endocytosis pcad04510   Focal adhesion pcad05020   Prion disease pcad05100   Bacterial invasion of epithelial cells pcad05205   Proteoglycans in cancer pcad05410   Hypertrophic cardiomyopathy pcad05412   Arrhythmogenic right ventricular cardiomyopathy pcad05414   Dilated cardiomyopathy pcad05416   Viral myocarditis pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112064949   09144 Cellular community - eukaryotes    04510 Focal adhesion     112064949  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     112064949   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112064949   09164 Neurodegenerative disease    05020 Prion disease     112064949   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112064949    05410 Hypertrophic cardiomyopathy     112064949    05412 Arrhythmogenic right ventricular cardiomyopathy     112064949    05414 Dilated cardiomyopathy     112064949    05416 Viral myocarditis     112064949  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     112064949 Membrane trafficking [BR:pcad04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     112064949 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  112064949 NCBI-ProteinID:  XP_054936044 UniProt:  A0A9W2W9U6 LinkDB All DBs Position 18:complement(12078901..12085097) Genome browser AA seq 123 aa AA seqDB search MQRTGCWFPEVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLW GFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCGNIKVMLR KEV NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcagaggacaggctgctggtttccagaggtggatttcgaagacgtgatcgcggagccc gtgggcacgtacagctttgatggcgtgtggaaggtgagctacaccaccttcaccgtctcc aagtactggtgctaccgcctgctatccacgctgctgggggtcccgctggccctgctctgg ggcttcctgttcgcctgcatctccttctgccacatctgggcggtggtgccctgcatcaag agctacctgatcgagatccagtgcatcagccacatctactcgctctgcatccgcaccttc tgcaacccgctcttcgctgccctgggccaggtctgcggcaacatcaaggtgatgctgcgg aaagaagtgtga

DBGET integrated database retrieval system