Physeter macrocephalus (sperm whale): 112065202 Help Entry 112065202         CDS       T06011                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     112065202  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcad03019]     112065202    03029 Mitochondrial biogenesis [BR:pcad03029]     112065202 Messenger RNA biogenesis [BR:pcad03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      112065202 Mitochondrial biogenesis [BR:pcad03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     112065202 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  112065202 NCBI-ProteinID:  XP_023980670 Ensembl:  ENSPCTG00005020452 UniProt:  A0A2Y9SVU7 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCVAGGSCTCADSCKCKECKCTSCKKSCCPCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgcgtcgcgggtggatcctgcacgtgtgccgactcctgcaaa tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgcccctgctgccccgtgggc tgcgccaagtgtgcccagggctgcgtgtgcaaaggggcctcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system