Physeter macrocephalus (sperm whale): 112066514 Help Entry 112066514         CDS       T06011                                  Symbol MTLN Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism pcad  Physeter macrocephalus (sperm whale) Brite KEGG Orthology (KO) [BR:pcad00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pcad03029]     112066514 (MTLN) Mitochondrial biogenesis [BR:pcad03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     112066514 (MTLN) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom CheW_CheR_link Motif Other DBs NCBI-GeneID:  112066514 NCBI-ProteinID:  XP_023985572 UniProt:  A0A2Y9T7I2 LinkDB All DBs Position 12:14835408..14836474 Genome browser AA seq 56 aa AA seqDB search MANVSERTLQLSVLVAFASGVLVGWQAHRLRRRYLDWRKKRLQDKLAATQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcgaacgtgtccgagaggacgttgcagctgtcggtgctggtggccttcgcctccgga gtgctcgtgggttggcaggcacaccggctgcggcggcgctacctggactggagaaagaag aggctgcaagacaagctggcggcgacgcagaagaagctggacctggcctga

DBGET integrated database retrieval system