Physeter macrocephalus (sperm whale): 112067521 Help Entry 112067521         CDS       T06011                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04010   MAPK signaling pathway pcad04020   Calcium signaling pathway pcad04022   cGMP-PKG signaling pathway pcad04114   Oocyte meiosis pcad04218   Cellular senescence pcad04310   Wnt signaling pathway pcad04360   Axon guidance pcad04370   VEGF signaling pathway pcad04380   Osteoclast differentiation pcad04625   C-type lectin receptor signaling pathway pcad04650   Natural killer cell mediated cytotoxicity pcad04658   Th1 and Th2 cell differentiation pcad04659   Th17 cell differentiation pcad04660   T cell receptor signaling pathway pcad04662   B cell receptor signaling pathway pcad04720   Long-term potentiation pcad04724   Glutamatergic synapse pcad04921   Oxytocin signaling pathway pcad04922   Glucagon signaling pathway pcad04924   Renin secretion pcad05010   Alzheimer disease pcad05014   Amyotrophic lateral sclerosis pcad05020   Prion disease pcad05022   Pathways of neurodegeneration - multiple diseases pcad05031   Amphetamine addiction pcad05152   Tuberculosis pcad05163   Human cytomegalovirus infection pcad05166   Human T-cell leukemia virus 1 infection pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05170   Human immunodeficiency virus 1 infection pcad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112067521 (PPP3R1)    04310 Wnt signaling pathway     112067521 (PPP3R1)    04370 VEGF signaling pathway     112067521 (PPP3R1)    04020 Calcium signaling pathway     112067521 (PPP3R1)    04022 cGMP-PKG signaling pathway     112067521 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112067521 (PPP3R1)    04218 Cellular senescence     112067521 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112067521 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     112067521 (PPP3R1)    04660 T cell receptor signaling pathway     112067521 (PPP3R1)    04658 Th1 and Th2 cell differentiation     112067521 (PPP3R1)    04659 Th17 cell differentiation     112067521 (PPP3R1)    04662 B cell receptor signaling pathway     112067521 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     112067521 (PPP3R1)    04921 Oxytocin signaling pathway     112067521 (PPP3R1)    04924 Renin secretion     112067521 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     112067521 (PPP3R1)    04720 Long-term potentiation     112067521 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     112067521 (PPP3R1)    04380 Osteoclast differentiation     112067521 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112067521 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112067521 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     112067521 (PPP3R1)    05163 Human cytomegalovirus infection     112067521 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     112067521 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     112067521 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     112067521 (PPP3R1)    05014 Amyotrophic lateral sclerosis     112067521 (PPP3R1)    05020 Prion disease     112067521 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     112067521 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     112067521 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112067521 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcad01009]     112067521 (PPP3R1) Protein phosphatases and associated proteins [BR:pcad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112067521 (PPP3R1) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg EF-hand_9 RSA-1_C Motif Other DBs NCBI-GeneID:  112067521 NCBI-ProteinID:  XP_023989325 Ensembl:  ENSPCTG00005008639 UniProt:  A0A2Y9TJR4 LinkDB All DBs Position 12:complement(82932076..82998096) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg gaagagttcatgtctctgcctgagttacaacagaatcccttagtacagcgagtaatagat atatttgacacagatgggaatggagaagtagactttaaagagttcattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacacagttacagcaaattgtggacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggcggcctc gatattcacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system