Physeter macrocephalus (sperm whale): 114487348 Help Entry 114487348         CDS       T06011                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04621   NOD-like receptor signaling pathway pcad05012   Parkinson disease pcad05132   Salmonella infection pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     114487348  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114487348   09164 Neurodegenerative disease    05012 Parkinson disease     114487348   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     114487348  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pcad03110]     114487348 Chaperones and folding catalysts [BR:pcad03110]  Protein folding catalysts   Protein disulfide isomerase    114487348 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin DIM1 Thioredoxin_8 Thioredoxin_7 Thioredoxin_9 AhpC-TSA Thioredoxin_2 Motif Other DBs NCBI-GeneID:  114487348 NCBI-ProteinID:  XP_054945043 UniProt:  A0A9W2X0X0 LinkDB All DBs Position 12:complement(43736632..43738353) Genome browser AA seq 112 aa AA seqDB search MVKQIESKYAFQEALNNAGEKLLVVDFSATWCGTCEMIKPFFHSLCEKYSNMVFLKVDVD DCQDVASECEVKCMATFQFFKKEQKAGELSGTNKENLEATINELISTCFLKT NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagtaagtatgcttttcaggaggccttgaacaatgcaggagag aaactcctagtagtcgacttctcagccacatggtgtgggacttgcgaaatgatcaagcct ttctttcattctctctgtgaaaagtattccaacatggtgttcctcaaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatggcaaccttccagtttttt aaaaaggaacagaaagcaggtgaactttctggcaccaataaggaaaaccttgaagccacc attaatgaattaatctcaacatgttttctgaagacatga

DBGET integrated database retrieval system