Physeter macrocephalus (sperm whale): 114487447 Help Entry 114487447         CDS       T06011                                  Name (RefSeq) adenylate kinase 8-like   KO K00939   adenylate kinase [EC:2.7.4.3] Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad00230   Purine metabolism pcad00730   Thiamine metabolism pcad01100   Metabolic pathways pcad01232   Nucleotide metabolism pcad01240   Biosynthesis of cofactors Module pcad_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP Brite KEGG Orthology (KO) [BR:pcad00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     114487447   09108 Metabolism of cofactors and vitamins    00730 Thiamine metabolism     114487447  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     114487447 Enzymes [BR:pcad01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.3  adenylate kinase      114487447 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    114487447 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADK Motif Other DBs NCBI-GeneID:  114487447 NCBI-ProteinID:  XP_028353175 UniProt:  A0A455BVZ7 LinkDB All DBs Position 13:85439576..85441732 Genome browser AA seq 118 aa AA seqDB search MVELTRVPVLPRRVFFLNVPFDSILERLTLRRTDPVTGERSHLMYKPPPTMEIQARLLQS PKDSEEQIKLRMDRFYRNSAELEEFYGQAITLNGDQDPYTVFEYIESGIINPLRKKAP NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggtggagctgaccagggtgcctgttcttcctcgtagggtgtttttcctgaatgtgcca ttcgattccatccttgagcggctgaccctgagaagaaccgaccctgtcacaggagaaagg tcccacctcatgtacaagccgcctccgaccatggaaatccaggcccgtctcctgcagagc ccaaaggattctgaagagcagatcaagctcagaatggatcggttctacaggaattccgct gagctggaggagttctatgggcaggccatcaccctcaatggggaccaggacccgtacacg gtctttgaatacatagagagtgggatcattaatcccctgcgcaagaaagctccctga

DBGET integrated database retrieval system