Physeter macrocephalus (sperm whale): 129392645 Help Entry 129392645         CDS       T06011                                  Name (RefSeq) neo-calmodulin-like   KO K02183   calmodulin Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04014   Ras signaling pathway pcad04015   Rap1 signaling pathway pcad04020   Calcium signaling pathway pcad04022   cGMP-PKG signaling pathway pcad04024   cAMP signaling pathway pcad04070   Phosphatidylinositol signaling system pcad04114   Oocyte meiosis pcad04218   Cellular senescence pcad04261   Adrenergic signaling in cardiomyocytes pcad04270   Vascular smooth muscle contraction pcad04371   Apelin signaling pathway pcad04625   C-type lectin receptor signaling pathway pcad04713   Circadian entrainment pcad04720   Long-term potentiation pcad04722   Neurotrophin signaling pathway pcad04728   Dopaminergic synapse pcad04740   Olfactory transduction pcad04744   Phototransduction pcad04750   Inflammatory mediator regulation of TRP channels pcad04910   Insulin signaling pathway pcad04912   GnRH signaling pathway pcad04915   Estrogen signaling pathway pcad04916   Melanogenesis pcad04921   Oxytocin signaling pathway pcad04922   Glucagon signaling pathway pcad04924   Renin secretion pcad04925   Aldosterone synthesis and secretion pcad04970   Salivary secretion pcad04971   Gastric acid secretion pcad05010   Alzheimer disease pcad05012   Parkinson disease pcad05022   Pathways of neurodegeneration - multiple diseases pcad05031   Amphetamine addiction pcad05034   Alcoholism pcad05133   Pertussis pcad05152   Tuberculosis pcad05163   Human cytomegalovirus infection pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05170   Human immunodeficiency virus 1 infection pcad05200   Pathways in cancer pcad05214   Glioma pcad05417   Lipid and atherosclerosis pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129392645    04015 Rap1 signaling pathway     129392645    04371 Apelin signaling pathway     129392645    04020 Calcium signaling pathway     129392645    04070 Phosphatidylinositol signaling system     129392645    04024 cAMP signaling pathway     129392645    04022 cGMP-PKG signaling pathway     129392645  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129392645    04218 Cellular senescence     129392645  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129392645   09152 Endocrine system    04910 Insulin signaling pathway     129392645    04922 Glucagon signaling pathway     129392645    04912 GnRH signaling pathway     129392645    04915 Estrogen signaling pathway     129392645    04921 Oxytocin signaling pathway     129392645    04916 Melanogenesis     129392645    04924 Renin secretion     129392645    04925 Aldosterone synthesis and secretion     129392645   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     129392645    04270 Vascular smooth muscle contraction     129392645   09154 Digestive system    04970 Salivary secretion     129392645    04971 Gastric acid secretion     129392645   09156 Nervous system    04728 Dopaminergic synapse     129392645    04720 Long-term potentiation     129392645    04722 Neurotrophin signaling pathway     129392645   09157 Sensory system    04744 Phototransduction     129392645    04740 Olfactory transduction     129392645    04750 Inflammatory mediator regulation of TRP channels     129392645   09159 Environmental adaptation    04713 Circadian entrainment     129392645  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129392645   09162 Cancer: specific types    05214 Glioma     129392645   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129392645    05163 Human cytomegalovirus infection     129392645    05167 Kaposi sarcoma-associated herpesvirus infection     129392645   09171 Infectious disease: bacterial    05133 Pertussis     129392645    05152 Tuberculosis     129392645   09164 Neurodegenerative disease    05010 Alzheimer disease     129392645    05012 Parkinson disease     129392645    05022 Pathways of neurodegeneration - multiple diseases     129392645   09165 Substance dependence    05031 Amphetamine addiction     129392645    05034 Alcoholism     129392645   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129392645    05418 Fluid shear stress and atherosclerosis     129392645  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcad01009]     129392645   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     129392645    03036 Chromosome and associated proteins [BR:pcad03036]     129392645   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     129392645 Protein phosphatases and associated proteins [BR:pcad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129392645 Membrane trafficking [BR:pcad04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129392645 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129392645 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129392645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen Caleosin DUF1103 TerB DUF5580_M FCaBP_EF-hand Poly_export SurA_N_3 SPEF2_C Fe_hyd_lg_C PA_Ig-like MecA_N Motif Other DBs NCBI-GeneID:  129392645 NCBI-ProteinID:  XP_054945144 UniProt:  A0A9W2X110 LinkDB All DBs Position 12:complement(63300476..63302730) Genome browser AA seq 149 aa AA seqDB search MIYQHTLISSTEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgatttaccaacatactttaatatcaagcacagaattcaaagaagctttttcactattt gacaaggatggtgatggaactataacaacaaaggagttgggaactgtaatgaggtctctt gggcagaatcccacagaagcagagttacaggacatgattaatgaggtggatgctgatggt aatggcacaattgacttcccggaatttctgacaatgatggcaagaaaaatgaaagacaca gacagtgaagaagaaattagagaagcattccgtgtgtttgataaggatggtaatggctat attagtgcagcagagctccgccatgtgatgacaaaccttggagagaagttaacagatgaa gaggttgatgaaatgatcagggaagcagacattgatggtgatggtcaagtaaactatgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system