Physeter macrocephalus (sperm whale): 809409 Help Entry 809409            CDS       T06011                                  Symbol ND3, KEF67_p06 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad00190   Oxidative phosphorylation pcad01100   Metabolic pathways pcad04714   Thermogenesis pcad04723   Retrograde endocannabinoid signaling pcad05010   Alzheimer disease pcad05012   Parkinson disease pcad05014   Amyotrophic lateral sclerosis pcad05016   Huntington disease pcad05020   Prion disease pcad05022   Pathways of neurodegeneration - multiple diseases pcad05208   Chemical carcinogenesis - reactive oxygen species pcad05415   Diabetic cardiomyopathy Module pcad_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pcad00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     809409 (ND3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     809409 (ND3)   09159 Environmental adaptation    04714 Thermogenesis     809409 (ND3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     809409 (ND3)   09164 Neurodegenerative disease    05010 Alzheimer disease     809409 (ND3)    05012 Parkinson disease     809409 (ND3)    05014 Amyotrophic lateral sclerosis     809409 (ND3)    05016 Huntington disease     809409 (ND3)    05020 Prion disease     809409 (ND3)    05022 Pathways of neurodegeneration - multiple diseases     809409 (ND3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     809409 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pcad03029]     809409 (ND3) Enzymes [BR:pcad01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      809409 (ND3) Mitochondrial biogenesis [BR:pcad03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     809409 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 TrbC Motif Other DBs NCBI-GeneID:  809409 NCBI-ProteinID:  NP_062474 UniProt:  Q9MES9 LinkDB All DBs Position MT:9510..9855 Genome browser AA seq 115 aa AA seqDB search MNILLTLLTNTTLALLLMLIAFWLPQLNAYTEKTSPYECGFDPMQSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWATQMNNLKTMLTTALFLISLLAASLAYEWTQEGLEWAE NT seq 346 nt NT seq  +upstreamnt  +downstreamnt ataaacattctactgacactcctaacaaacacaacactagccctgttactaatacttatc gccttctgactcccccagttaaatgcatacactgaaaagacaagcccctacgaatgtggc tttgaccctatacaatctgcccgcctacccttttccataaagttcttcctagtcgcaatt accttccttctcttcgacctagaaatcgccctcctattgcccctcccctgagcaacccaa ataaataacctaaaaacaatacttaccacagccctattcctaatctccttattagcagct agcctcgcctacgaatgaacccaagaaggcttagaatgagccgaat

DBGET integrated database retrieval system