Paraburkholderia caffeinilytica: DSC91_005333 Help Entry DSC91_005333      CDS       T06448                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pcaf  Paraburkholderia caffeinilytica Brite KEGG Orthology (KO) [BR:pcaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pcaf03032]     DSC91_005333    03036 Chromosome and associated proteins [BR:pcaf03036]     DSC91_005333    03400 DNA repair and recombination proteins [BR:pcaf03400]     DSC91_005333 DNA replication proteins [BR:pcaf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DSC91_005333 Chromosome and associated proteins [BR:pcaf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DSC91_005333 DNA repair and recombination proteins [BR:pcaf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DSC91_005333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AXL52359 LinkDB All DBs Position 2:2111444..2111722 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGQTGASKAQTGETLDTLLEVIKKSVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgcaggacaaaccggcgccagcaaggctcaa accggtgagacgctggacacgttgctcgaagtgatcaagaagtctgtgtcgaagggtgac gcggtccagctgatcggcttcggcagcttcggttcgggcaagcgcgcagcacgtacgggt cgtaaccccaagaccggcgaaactatcaagatcccggccgccaagaccgtcaagttcacg gctggtaaggcgttcaaggacgcggtcaacaagcgctaa

DBGET integrated database retrieval system