Paraburkholderia caffeinilytica: DSC91_005781
Help
Entry
DSC91_005781 CDS
T06448
Name
(GenBank) single-stranded DNA-binding protein
KO
K03111
single-strand DNA-binding protein
Organism
pcaf
Paraburkholderia caffeinilytica
Pathway
pcaf03030
DNA replication
pcaf03430
Mismatch repair
pcaf03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
pcaf00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
DSC91_005781
03430 Mismatch repair
DSC91_005781
03440 Homologous recombination
DSC91_005781
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
pcaf03032
]
DSC91_005781
03400 DNA repair and recombination proteins [BR:
pcaf03400
]
DSC91_005781
03029 Mitochondrial biogenesis [BR:
pcaf03029
]
DSC91_005781
DNA replication proteins [BR:
pcaf03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
DSC91_005781
DNA repair and recombination proteins [BR:
pcaf03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
DSC91_005781
TLS (translesion DNA synthesis) factors
Other SOS response factors
DSC91_005781
Mitochondrial biogenesis [BR:
pcaf03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
DSC91_005781
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID:
AXL52670
UniProt:
A0ABQ1M0A8
LinkDB
All DBs
Position
2:2569983..2570522
Genome browser
AA seq
179 aa
AA seq
DB search
MASVNKVILVGNLGADPEVRYLPSGDALANIRLATTDRYKDKASGEFKEATEWHRVVFFG
RLAEIVSEYLKKGSSVYLEGRIRTRKWQAQDGTDRYSTEIVAEQMQMLGGRGGSAGGGGG
DEGGYSRGEPSERSGGGGGGRAVSGGGASRGGSGGGGGASRPSAPAGGGFDEMDDDIPF
NT seq
540 nt
NT seq
+upstream
nt +downstream
nt
atggcatccgtgaacaaggtcattctcgtcggcaatctcggagccgatccggaagtccgt
tatcttccgagcggcgacgcactggcgaacatccgccttgcgacaacggatcggtacaag
gacaaagcgtccggcgaattcaaggaagcaaccgagtggcaccgcgtggtgttcttcggc
cgcctcgctgaaatcgtgtccgaatatctgaagaaaggctcgtcggtgtacctcgaaggg
cgcattcgcacgcgcaagtggcaggcacaggacggcaccgaccgttactcgacggaaatc
gtcgccgagcagatgcaaatgctgggtggccgtggcggctcggcgggcggcggcggtggc
gatgaaggcggttacagccgcggtgagccgtcggagcgtagtggcggcggtggtggcggc
cgtgcggtttcgggtggcggtgcttcgcgtggcggcagcggtggtggcggtggtgcgagc
cgtccgagcgcgccggccggcggtgggtttgatgagatggatgacgatattccgttctga
DBGET
integrated database retrieval system