Saccharococcus caldoxylosilyticus: BV455_00682 Help Entry BV455_00682       CDS       T07489                                  Symbol acpA Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pcal  Saccharococcus caldoxylosilyticus Pathway pcal00998   Biosynthesis of various antibiotics pcal01100   Metabolic pathways pcal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BV455_00682 (acpA)    00074 Mycolic acid biosynthesis     BV455_00682 (acpA)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BV455_00682 (acpA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 PP-binding_2 SAPS Motif Other DBs NCBI-ProteinID:  QXJ37420 LinkDB All DBs Position complement(658679..658912) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEESQVTLDASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSHM NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtattagaacgcgtaacgaaaatcatcgtagaccgtctaggtgtcgaagaa tcgcaagtaacgctggatgcttctttcaaagatgatcttggcgctgactccctagatatc gttgaactcgtaatggaattagaagatgaatttaatatggaaatttccgatgaagaggcg gaaaaaattgtcacagtaggagacgctgtgaactacataaaaagccacatgtaa

DBGET integrated database retrieval system