Aquipseudomonas campi: HNE05_05815 Help Entry HNE05_05815       CDS       T07561                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcam  Aquipseudomonas campi Pathway pcam01100   Metabolic pathways pcam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HNE05_05815 (acpP)    00074 Mycolic acid biosynthesis     HNE05_05815 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HNE05_05815 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QKE62894 UniProt:  A0A6M8F359 LinkDB All DBs Position 1771959..1772192 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKIVAEQLGVKEDEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgttaaagaa gacgaagtcaccaacagtgcttccttcgtcgaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagactgaaatcccggacgagcaagct gagaaaatcaccaccgttcaggaagccatcgactacatcaacgcccacggctga

DBGET integrated database retrieval system