Phalacrocorax carbo (great cormorant): 104039851 Help Entry 104039851         CDS       T08596                                  Name (RefSeq) histone H2B type 1-B   KO K11252   histone H2B Organism pcao  Phalacrocorax carbo (great cormorant) Brite KEGG Orthology (KO) [BR:pcao00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcao03036]     104039851   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcao04147]     104039851 Chromosome and associated proteins [BR:pcao03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104039851 Exosome [BR:pcao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104039851 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like LonB_AAA-LID DUF1931 Motif Other DBs NCBI-GeneID:  104039851 NCBI-ProteinID:  XP_009511699 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search SYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQ TAVRLLLPGELA NT seq 218 nt NT seq  +upstreamnt  +downstreamnt agctactcgatctacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcg tccaaggccatgggcatcatgaactccttcgtgaacgacatcttcgagcgcatcgccggc gaggcctctcgcctggcgcactacaacaagcgctccaccatcacctcgcgggagatccag acggccgtgcggctcctgctgcccggcgagctggccaa

DBGET integrated database retrieval system