Phalacrocorax carbo (great cormorant): 104041700 Help Entry 104041700         CDS       T08596                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pcao  Phalacrocorax carbo (great cormorant) Pathway pcao04115   p53 signaling pathway pcao04137   Mitophagy - animal pcao04140   Autophagy - animal pcao04210   Apoptosis pcao04621   NOD-like receptor signaling pathway pcao05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pcao00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104041700 (BCL2L1)    04137 Mitophagy - animal     104041700 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     104041700 (BCL2L1)    04115 p53 signaling pathway     104041700 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104041700 (BCL2L1)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     104041700 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcao01009]     104041700 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcao03036]     104041700 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pcao02000]     104041700 (BCL2L1) Protein phosphatases and associated proteins [BR:pcao01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      104041700 (BCL2L1) Chromosome and associated proteins [BR:pcao03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     104041700 (BCL2L1) Transporters [BR:pcao02000]  Other transporters   Pores ion channels [TC:1]    104041700 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  104041700 NCBI-ProteinID:  XP_009499299 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSSNQELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNGSPSWHPPASH VVNGATVHRSSLEVHEIVQAADVRQALREAGDEFELRYRQAFSDLTSQLHITPGTAYQSF EQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRIVSWMTTYLTDHLDPWIQ ENGGWVRTPLPAMFMLVLVLGLVGR NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcagtaaccaggagttagtgattgactttgtttcctacaagctctcgcagaag ggatacagctggagtcagctggaggaggaggatgagaacaggactgactttgcagcggag gaggctgagatggacggcgtcctcaatgggagcccctcctggcatccacccgccagccac gtagtgaacggagccactgtgcaccggagcagcctcgaagtccatgaaatcgttcaagca gctgatgtgaggcaggcactgagagaggcgggggatgagtttgagttgaggtacaggcag gctttcagcgacctcacttcccagctccacatcacccctggcacagcgtatcagagcttt gagcaggtagtgaatgaactcttccgtgacggagtgaactggggtcgcattgtggctttc ttctccttcggaggagccttgtgcgtggagagcgttgacaaggagatgcgggtattggtg ggacgcattgtgtcttggatgaccacgtacttgaccgaccacctagatccctggatccag gagaatggcggatgggtaagaactccgctccctgcaatgtttatgctagtgcttgtccta ggccttgtagggagataa

DBGET integrated database retrieval system