Phalacrocorax carbo (great cormorant): 104044191 Help Entry 104044191         CDS       T08596                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism pcao  Phalacrocorax carbo (great cormorant) Pathway pcao04060   Cytokine-cytokine receptor interaction pcao04218   Cellular senescence pcao04620   Toll-like receptor signaling pathway pcao04621   NOD-like receptor signaling pathway pcao04622   RIG-I-like receptor signaling pathway pcao05132   Salmonella infection pcao05164   Influenza A Brite KEGG Orthology (KO) [BR:pcao00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104044191  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104044191  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104044191    04621 NOD-like receptor signaling pathway     104044191    04622 RIG-I-like receptor signaling pathway     104044191  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104044191   09171 Infectious disease: bacterial    05132 Salmonella infection     104044191  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcao04052]     104044191    00536 Glycosaminoglycan binding proteins [BR:pcao00536]     104044191 Cytokines and neuropeptides [BR:pcao04052]  Cytokines   Chemokines    104044191 Glycosaminoglycan binding proteins [BR:pcao00536]  Heparan sulfate / Heparin   Chemokines    104044191 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104044191 NCBI-ProteinID:  XP_009502271 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MMLAAELRCRCIQTVTGFMLPKRLANVEIIPKGPYCNVVEIIAMLKNNQQICLDPQAKWV KIIINRILN NT seq 209 nt NT seq  +upstreamnt  +downstreamnt atgatgctggcagcagagctgcggtgtcgctgcatccagactgtcacaggattcatgttg ccaaagcgcctggccaacgtggaaatcattccaaagggcccatactgcaatgttgtggaa atcatagcaatgctgaagaacaaccagcagatctgcttagatccccaggccaaatgggtg aagatcatcattaacaggattctaaacag

DBGET integrated database retrieval system