Phalacrocorax carbo (great cormorant): 104044440 Help Entry 104044440         CDS       T08596                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism pcao  Phalacrocorax carbo (great cormorant) Pathway pcao04010   MAPK signaling pathway pcao04012   ErbB signaling pathway pcao04068   FoxO signaling pathway pcao04137   Mitophagy - animal pcao04140   Autophagy - animal pcao04144   Endocytosis pcao04150   mTOR signaling pathway pcao04210   Apoptosis pcao04218   Cellular senescence pcao04370   VEGF signaling pathway pcao04371   Apelin signaling pathway pcao04510   Focal adhesion pcao04540   Gap junction pcao04625   C-type lectin receptor signaling pathway pcao04810   Regulation of actin cytoskeleton pcao04910   Insulin signaling pathway pcao04912   GnRH signaling pathway pcao04916   Melanogenesis pcao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104044440 (HRAS)    04012 ErbB signaling pathway     104044440 (HRAS)    04370 VEGF signaling pathway     104044440 (HRAS)    04371 Apelin signaling pathway     104044440 (HRAS)    04068 FoxO signaling pathway     104044440 (HRAS)    04150 mTOR signaling pathway     104044440 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104044440 (HRAS)    04140 Autophagy - animal     104044440 (HRAS)    04137 Mitophagy - animal     104044440 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104044440 (HRAS)    04218 Cellular senescence     104044440 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104044440 (HRAS)    04540 Gap junction     104044440 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104044440 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104044440 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104044440 (HRAS)    04912 GnRH signaling pathway     104044440 (HRAS)    04916 Melanogenesis     104044440 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104044440 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcao04131]     104044440 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcao04147]     104044440 (HRAS)    04031 GTP-binding proteins [BR:pcao04031]     104044440 (HRAS) Membrane trafficking [BR:pcao04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104044440 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104044440 (HRAS) Exosome [BR:pcao04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104044440 (HRAS)   Exosomal proteins of colorectal cancer cells    104044440 (HRAS) GTP-binding proteins [BR:pcao04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104044440 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  104044440 NCBI-ProteinID:  XP_009502559 UniProt:  A0A093QQD9 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggagctggtggtgttgggaagagtgcattgacg atacagctcattcagaaccacttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaggttgtcattgatggtgagacctgcttgttagacatcttggataccgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgc gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaggactcggatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagccaggacagtggagactcggcaagcacaggacctggcccggagttatgggatcccc tacatagaaacgtctgccaaaaccagacagggcgttgaagatgccttctataccttggtg cgagagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccctggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system