Phalacrocorax carbo (great cormorant): 104047388 Help Entry 104047388         CDS       T08596                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism pcao  Phalacrocorax carbo (great cormorant) Pathway pcao04010   MAPK signaling pathway pcao04068   FoxO signaling pathway pcao04081   Hormone signaling pcao04114   Oocyte meiosis pcao04140   Autophagy - animal pcao04150   mTOR signaling pathway pcao04810   Regulation of actin cytoskeleton pcao04910   Insulin signaling pathway pcao04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:pcao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104047388 (INS)    04068 FoxO signaling pathway     104047388 (INS)    04150 mTOR signaling pathway     104047388 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104047388 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104047388 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104047388 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104047388 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104047388 (INS)    04914 Progesterone-mediated oocyte maturation     104047388 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcao04052]     104047388 (INS) Cytokines and neuropeptides [BR:pcao04052]  Neuropeptides   Unclassified    104047388 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104047388 NCBI-ProteinID:  XP_009505989 UniProt:  A0A093QVU8 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSGPGTSHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ PLVSGPLHGEVGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctctcctggcccttctcgctctttctggccctggg accagccacgcagctgccaatcagcacctctgcggctcccacttggtggaggctctctac ctggtgtgtggagagcggggtttcttctactcccccaaagcccgacgggacattgagcag cctctagtgagcggtcccttgcatggtgaggtaggagagctgcccttccagcaggaggag tttgagaaagtgaagcgagggattgttgagcaatgctgccacaacacatgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system