Phalacrocorax carbo (great cormorant): 104047840 Help Entry 104047840         CDS       T08596                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism pcao  Phalacrocorax carbo (great cormorant) Brite KEGG Orthology (KO) [BR:pcao00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcao03036]     104047840   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcao04147]     104047840 Chromosome and associated proteins [BR:pcao03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104047840 Exosome [BR:pcao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104047840 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S Motif Other DBs NCBI-GeneID:  104047840 NCBI-ProteinID:  XP_009506492 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search PGTVALREIRRYQKSTELLQAALTAFLLVLLKQEASEAYLVGLFEDTNLCAIHAKRVTIM PKDIQLARRIRGERA NT seq 229 nt NT seq  +upstreamnt  +downstreamnt gccgggcaccgtcgccctccgtgagatccgtcgttaccaaaaatcgacggagctgctgca agctgccctaacggcgtttcttcttgtgctcttgaaacaggaggccagcgaagcgtatct ggtgggtctgttcgaggatacaaacctgtgcgccatccatgccaagagagtcaccatcat gcccaaagacatccagttggctcgcaggatacggggggagagggcttaa

DBGET integrated database retrieval system