Phalacrocorax carbo (great cormorant): 104052886 Help Entry 104052886         CDS       T08596                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism pcao  Phalacrocorax carbo (great cormorant) Pathway pcao04810   Regulation of actin cytoskeleton pcao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcao00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104052886 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104052886 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcao04131]     104052886 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pcao04812]     104052886 (PFN2)    04147 Exosome [BR:pcao04147]     104052886 (PFN2) Membrane trafficking [BR:pcao04131]  Others   Actin-binding proteins    Others     104052886 (PFN2) Cytoskeleton proteins [BR:pcao04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104052886 (PFN2) Exosome [BR:pcao04147]  Exosomal proteins   Proteins found in most exosomes    104052886 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104052886 NCBI-ProteinID:  XP_009512531 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search PVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVG RAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ccagtagaaatagatatgattgtaggaaaagaccgagagggtttcttcaccaatggtctg acccttggtgcaaagaagtgctctgtgatcagagatagcctgtatgttgatggtgactgc acaatggacatcaggacaaagagtcaaggtggtgagccaacatacaatgttgctgtaggc agagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggcggattg aataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system