Pseudomonas alvandae B21-020: LOY40_02485 Help Entry LOY40_02485       CDS       T08625                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcas  Pseudomonas alvandae B21-020 Pathway pcas01100   Metabolic pathways pcas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LOY40_02485    00074 Mycolic acid biosynthesis     LOY40_02485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LOY40_02485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UVM73064 LinkDB All DBs Position complement(551114..551368) Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELDPERVTLESNLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKSVRTVNDVVEAVYRLVQPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaactcgtgacgatatcttcaacaccctgcgcgatgccctggtcgagctcttcgaa ctggaccctgagcgtgtaacgctggaatcgaacctgtaccaggacctggaaatcgacagc attgatgcggtggacctgatcgaccacatcaagcgccagaccggcaagaaaatcgccgcc gaagaattcaagtcggtgcgcacggtcaacgacgtggtcgaggcggtctatcgactggtc caaccggccgcatga

DBGET integrated database retrieval system