Pseudomonas alvandae B21-020: LOY40_17040 Help Entry LOY40_17040       CDS       T08625                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcas  Pseudomonas alvandae B21-020 Pathway pcas01100   Metabolic pathways pcas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LOY40_17040    00074 Mycolic acid biosynthesis     LOY40_17040   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LOY40_17040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UVM70313 LinkDB All DBs Position complement(3828728..3828979) Genome browser AA seq 83 aa AA seqDB search MTHVHEAKIKEIVSWVLGVNAEEIQNHKDFIEAYGADSMSGIEILAGIEGAFQVRVDETY IPRITSVDSILSFIDKTLEAECA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactcacgttcacgaagcaaaaatcaaggaaatcgtttcctgggtcttgggggtcaac gccgaagaaatccagaaccacaaggacttcatcgaagcttatggcgccgactcgatgtcg ggaatagaaatcctcgccggcatcgaaggtgcattccaggtgcgggtcgatgaaacctac atccccaggatcaccagtgtggattcgatactctcgtttatcgacaagacccttgaggct gagtgtgcatga

DBGET integrated database retrieval system