Candidatus Parvibacillus calidus: HWD63_03800 Help Entry HWD63_03800       CDS       T10915                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcau  Candidatus Parvibacillus calidus Pathway pcau01100   Metabolic pathways pcau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWD63_03800    00074 Mycolic acid biosynthesis     HWD63_03800   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWD63_03800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Ribosomal_L12_N Ribosomal_L50 DUF2624 Motif Other DBs NCBI-ProteinID:  QLH30869 LinkDB All DBs Position 872862..873104 Genome browser AA seq 80 aa AA seqDB search MSQSIEEKVRKIIVERLGVDESEVTLEASFTNDLGADSLDTVELIMELEKEFNISIPDEQ AEQIQTVGDAVSYLESQINA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcacaaagtattgaagaaaaagtcagaaaaatcattgttgaaagacttggtgttgat gagtctgaagtaactctggaagcaagctttaccaacgatcttggcgcagattctttagat acagttgagttaattatggagctggaaaaggaatttaatatctccattcctgacgagcag gctgagcaaattcaaactgtaggggatgctgtgtcttacctcgagtcacagatcaacgct taa

DBGET integrated database retrieval system