Candidatus Parvibacillus calidus: HWD63_06695 Help Entry HWD63_06695       CDS       T10915                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcau  Candidatus Parvibacillus calidus Pathway pcau01100   Metabolic pathways pcau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWD63_06695    00074 Mycolic acid biosynthesis     HWD63_06695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWD63_06695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DACNH Motif Other DBs NCBI-ProteinID:  QLH29092 LinkDB All DBs Position complement(1527843..1528100) Genome browser AA seq 85 aa AA seqDB search MEQLIDKLKSEIIEALNLQDMSPDDIDTDAPLFGTGLGLDSIDSLELMVLLERNYGIKIE DPREGRKVLESVRSMAQYIESFSNT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaacaattgatcgacaaattgaaaagcgaaattattgaagcattgaacctgcaggat atgagtccagatgatatcgacacggatgccccattgtttggaacagggctaggtctcgac agtattgattctttggagttaatggttttgctggaaagaaattacggaataaaaatagaa gatcccagagaaggccggaaagtactggagagtgttcgatccatggcccaatatattgag tcgtttagtaatacttaa

DBGET integrated database retrieval system