Candidatus Parvibacillus calidus: HWD63_15645 Help Entry HWD63_15645       CDS       T10915                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pcau  Candidatus Parvibacillus calidus Pathway pcau00190   Oxidative phosphorylation pcau01100   Metabolic pathways Module pcau_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pcau00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HWD63_15645 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pcau00194]     HWD63_15645 (atpE) Photosynthesis proteins [BR:pcau00194]  Photosystem and electron transport system   F-type ATPase [OT]    HWD63_15645 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF7261 Motif Other DBs NCBI-ProteinID:  QLH30680 UniProt:  A0A7D5RGC8 LinkDB All DBs Position complement(3699216..3699416) Genome browser AA seq 66 aa AA seqDB search MYAGIGAGLAAIGAGIGIGFIGGKGMEAIARQPEAVGDIRNNMLIIAAFVEAVALFAVVV AFLTAG NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgtacgcaggaattggagccggattggcggctatcggtgctggtatcggaattggattt atcggtggtaaaggtatggaggcgattgcccgccagcctgaagctgttggtgatatccgt aacaacatgttgatcattgcagccttcgttgaggcggttgcgcttttcgcagtggttgtt gcattccttacagcaggataa

DBGET integrated database retrieval system