Pseudomonas cavernae: D3880_07025
Help
Entry
D3880_07025 CDS
T08208
Name
(GenBank) response regulator
KO
K07678
two-component system, NarL family, sensor histidine kinase BarA [EC:
2.7.13.3
]
Organism
pcav
Pseudomonas cavernae
Pathway
pcav02020
Two-component system
pcav02025
Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:
pcav00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
D3880_07025
09140 Cellular Processes
09145 Cellular community - prokaryotes
02025 Biofilm formation - Pseudomonas aeruginosa
D3880_07025
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:
pcav01001
]
D3880_07025
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
pcav02022
]
D3880_07025
Enzymes [BR:
pcav01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.13 Protein-histidine kinases
2.7.13.3 histidine kinase
D3880_07025
Protein kinases [BR:
pcav01001
]
Histidine kinases
NarL family
D3880_07025
Two-component system [BR:
pcav02022
]
NarL family
BarA-UvrY (central carbon metabolism)
D3880_07025
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
HATPase_c
HisKA
sCache_4
HAMP
Hpt
HATPase_c_3
Motif
Other DBs
NCBI-ProteinID:
AYC32147
UniProt:
A0A385Z1Y7
LinkDB
All DBs
Position
complement(1517713..1520463)
Genome browser
AA seq
916 aa
AA seq
DB search
MFKDLGIKGRVLLLTLLPASLMALVLGGYFTWVQLAELEVQLLQRGQMIAEQLAPLAAPA
LARGDAEQLKRIARQTLEQPDVRAAGFLGAEHALLASAGPRMLNQPPSGDGTGLALRSGN
DATRFLLPVFGRHRNLTDSLPIADGERLLGWVELELSHHSTLLRGYRSLFASLLLIVAGL
FVTALLAVRLSRTINEPLRQIKQSVGQLKDGRLETRLPPLGSHELDEVASGINRMAEALQ
NAQEELQHNIEQATEDVRQNLETIEIQNIELDFARKEALEASRIKSEFLANMSHEIRTPL
NGILGFTRLLQKSELSPRQQDYLGTIEKSADSLLGIINEVLDFSKIEAGKLVLEHIPFNL
RDLLQDALTLLAPAAHAKQLELVSLVYRDTPLALIGDPQRLKQILTNLISNAIKFTRAGT
IVVRAMVEDENDDQAQLRISVQDTGIGLADEELRHLFQAFSQADNSLSRQTGGTGLGLVI
SKRLIEQMGGEIGVTSVPEQGSEFWISLALPKGRADAEDLPRAPLRGRRVAVLERHALAR
QALQHQLEDCGLQVLQYPSLDALHEGIAAQRHGEQPIGLAVLGVTAQELPPERLSQRIWE
LEGLDCKSLVLCPTTEQALYHDLLPVASSQLQAKPACTRKLQQALLELLGPRQPRAENPA
PLASRAARLLCVDDNPANLLLVQTLLEDMGAEVCAVDSGYAALERVQQQRFDLIFMDVQM
PGLDGRQTTEAIRQWESQRDGGALPIIALTAHALANEKRALLQAGMDDYLTKPISERQLA
QVVLKWTGLALRNQGQERAVDTHAGKTLSVLDAEEGLRLAAGKADLAADMLSMLLAGLPA
DRQAIHQARQAGERLALIERVHRLHGATRYCGVPQLRAACQRSETLLKQNDPAAALALDE
LDAAIVRLASEANLSA
NT seq
2751 nt
NT seq
+upstream
nt +downstream
nt
gtgttcaaagatctcggcatcaagggtcgcgttctgctgctcaccttactgcccgccagc
ctgatggccttggtcctgggcggctacttcacctgggtgcaactggccgagctggaagtg
cagctgctgcagcgcgggcagatgatcgccgagcaactggcgcctttggcggccccggct
ttggcgcggggtgatgccgaacaactgaaacggatcgccaggcagaccctggagcagccg
gatgtacgcgccgccggttttctcggcgccgaacacgcactgttggccagcgccggcccg
cgcatgctcaaccagccccccagtggcgacggcacgggcctggcgctgcgcagcggcaac
gacgccacgcgcttcctgctgccggtgttcggccgccaccgcaacctgaccgatagcctg
ccaatagcggacggtgaacgcttgctcggctgggtcgaactcgaactatcgcaccacagc
accctgctgcgcggctatcgcagcctgttcgccagcctgctgctgatcgtcgccggcctg
ttcgtcaccgcgttactggcggtgcgtctgagccgcaccatcaacgagccactgcggcag
atcaagcagagcgtcgggcaactcaaggacggccgcctggagacccgcctgccgccgctc
ggcagccatgaactggacgaagtcgccagcggcatcaaccgcatggccgaggcgctgcag
aacgcccaggaagagctgcagcacaacatcgagcaggccaccgaggatgtgcggcaaaac
ctggaaaccatcgagatccagaacatcgagctggacttcgcgcgcaaggaagccctggaa
gccagccggatcaaatccgaattcctcgccaacatgagccacgagatccgcacgccgctc
aacggcattctcggcttcacccgcctgttgcagaagagcgagctgagtccgcgccagcag
gactacctgggcaccatcgagaaatccgccgacagcctgctggggatcatcaacgaggtc
ctcgacttctccaagatcgaagccggcaagctggtgctcgagcacatccccttcaacctc
cgcgacctgctgcaggacgccctcaccctgctcgccccggccgcccacgccaagcagctg
gagctggtcagcctggtctatcgcgataccccgctggcgctgatcggcgatccgcagcgg
ctcaagcagatcctcaccaacttgatcagcaacgcgatcaagttcacccgcgccggtacc
atcgtcgttcgcgccatggtcgaggacgagaacgacgatcaggcgcagctgcgcatcagc
gtgcaggacaccggcatcggcctcgccgacgaggaattgcgccacctgttccaggccttc
agccaggcggacaactcgctgtcacggcaaaccggcggcaccggcctcggcctggtgatc
tccaagcgcctgatcgaacagatgggcggcgagatcggcgtcaccagcgttccagaacag
gggtcggagttctggatcagcctggcgctgccgaaaggccgcgcggatgccgaggacctg
ccgcgcgccccgctgcgtggtcgccgcgtggcggtgctggaacgtcatgccctggctcgc
caggccctgcagcaccagctcgaggattgcggcctgcaggtgctgcaataccccagtctc
gacgccctgcacgagggcatcgccgcgcagcgccacggcgagcagccgatcggcctggcg
gtgctcggggtgaccgcccaggagctgccgccagagcggctcagccagcgcatctgggag
ctcgaagggctcgactgcaagagcctggtgctctgccccaccaccgaacaggcgctctat
cacgacctgctgcccgtcgcttccagccaactgcaggccaaaccagcctgcacgcgcaaa
ctgcagcaggcgctgctcgaactgctcggcccgcgccagccgcgagcggaaaaccctgcg
ccgctggccagccgggcagcacgcctgctgtgtgtcgacgacaacccggccaacctgctg
ctggtgcagaccctgctggaagacatgggcgccgaggtctgcgccgtcgacagcggctac
gccgcgctggaacgcgtccagcagcagcgcttcgacctgatcttcatggacgtgcagatg
cccggcttggacggccgccagaccaccgaagcgatccgccagtgggaaagccagcgcgac
ggcggcgcgctgccgatcatcgccctcaccgctcacgccctggccaacgagaagcgcgcc
ctgctgcaggcgggcatggatgattacctgaccaagccgatcagcgagcgccagctggcc
caagtggtgctcaagtggaccggcctggcgctacgcaaccaaggccaggaacgggccgtc
gacacccacgccggcaagaccctgagcgtgctggatgccgaggaaggcctgcgcctggcc
gccggcaaggccgatctggccgcggacatgctgagcatgctgctggccgggctgcccgcc
gaccgccaggcgatccaccaggcccgccaagccggcgaacgcctggccctgatcgaacgc
gtgcatcgcctgcatggtgccacccgctactgcggcgtgccgcagctacgcgcggcctgc
cagcgcagcgaaaccctgctcaagcagaacgacccggctgccgccctggccctcgacgag
ttggacgccgccatcgtccgcctggccagcgaagccaatctcagcgcctga
DBGET
integrated database retrieval system