Pseudomonas cavernae: D3880_20360 Help Entry D3880_20360       CDS       T08208                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcav  Pseudomonas cavernae Pathway pcav01100   Metabolic pathways pcav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcav00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D3880_20360    00074 Mycolic acid biosynthesis     D3880_20360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D3880_20360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  AYC34582 UniProt:  A0A385Z9X1 LinkDB All DBs Position 4483567..4483824 Genome browser AA seq 85 aa AA seqDB search MQNRDEIFASLRDTLVELFELDPAQITLEANLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EDFKSVRTVHDVVEAVFRLVSAEGL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcagaaccgtgacgaaatctttgccagcctgcgcgacaccctggtcgagctgttcgag ctggacccggcgcagatcaccctggaggccaacctctaccaggacctggaaatcgacagc atcgacgcggtcgacctgatcgaccacatcaagcgccagaccggcaagaagatcgccgcc gaggacttcaagtcggtgcgcaccgtccatgacgtggtcgaggcggtgttccgcctggtg tccgcggaaggcctatga

DBGET integrated database retrieval system