Pseudomonas carboxydohydrogena: AFIC_001911 Help Entry AFIC_001911       CDS       T08963                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcax  Pseudomonas carboxydohydrogena Pathway pcax01100   Metabolic pathways pcax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcax00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFIC_001911    00074 Mycolic acid biosynthesis     AFIC_001911   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFIC_001911 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WEF50374 LinkDB All DBs Position complement(1982428..1982667) Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDTASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgcgtgaagaagatcgttgtggagcacctcggtgtcgaaccg gagaaagtggtggataccgcgagcttcatcgacgacctcggcgccgacagcctcgacact gtcgaactggtgatggctttcgaagaagaattcggttgcgagattccggacgacgcggcg gagaccatcctcacggttggcgacgccaccaagttcctcgaaaagaacgcgaagagctaa

DBGET integrated database retrieval system