Afipia carboxydohydrogena: AFIC_002511
Help
Entry
AFIC_002511 CDS
T08963
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
pcax
Afipia carboxydohydrogena
Pathway
pcax02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
pcax00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
AFIC_002511 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pcax02000
]
AFIC_002511 (phnC)
Enzymes [BR:
pcax01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
AFIC_002511 (phnC)
Transporters [BR:
pcax02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
AFIC_002511 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
SMC_N
AAA_16
AAA_22
AAA_29
AAA_23
nSTAND1
Mg_chelatase
AAA_13
AAA_33
Zeta_toxin
AAA_27
RsgA_GTPase
AAA_30
DO-GTPase2
nSTAND3
MMR_HSR1
TsaE
AAA_24
PRK
ORC-CDC6-like
NB-ARC
Motif
Other DBs
NCBI-ProteinID:
WEF50952
UniProt:
A0ABY8BRB2
LinkDB
All DBs
Position
complement(2605847..2606596)
Genome browser
AA seq
249 aa
AA seq
DB search
MKIAGLTKAFDGHAAIAQVSFDVHDGEFVAVLGPSGAGKTTLFRCMTGLLAPDDGSVRID
NNDIAAMRAHSRRRLAVVFQQFNLVNRLTALENVLAGRLGYVPAWRGWLRRFTRADRLLA
LECLDRVGLLAQAGQRADTLSGGQQQRVAIARALAQQPSLIVADEPVASLDPNASAGVLE
LLRGIARTDGVGVICSLHQVHFARAYADRIIGLSYGRIVIDVPSAKFDQAAYETLYGSQN
PASADPTSV
NT seq
750 nt
NT seq
+upstream
nt +downstream
nt
atgaaaatcgcaggtctgacgaaagcgttcgatggccacgccgccatcgcgcaggtcagc
ttcgacgtgcatgacggcgagttcgtcgcggtgctcgggccgagcggggcgggcaagacc
acgctgttccgttgcatgaccggtctgcttgcacccgatgacggcagcgtgcggatcgac
aacaacgacatcgccgcgatgcgtgctcactcgcgccgaaggcttgccgtggtgtttcag
cagttcaatctggtgaaccggttgaccgcgctcgagaacgtgctggccgggcggctcggt
tacgttccggcctggcgcggctggctgcggcgcttcacccgtgctgaccggctgctggcg
ctggaatgtctcgatcgcgtcggtctgctcgcgcaagccgggcagcgcgccgatacgctg
tccggcggccagcagcagcgtgtcgcgatcgcgcgggcgctggcgcagcagccgagcctg
atcgttgccgatgaaccggtcgcgagcctcgatccgaacgccagcgcaggcgtgctggaa
ctgctgcgcggcattgcacgtacggatggcgttggcgtgatatgcagcctgcatcaggtg
catttcgcgcgcgcctacgccgaccgcatcatcggcttgtcgtatggccgcatcgtcatc
gacgtgccgagcgcgaaattcgatcaggcggcgtacgaaaccctgtatggttcccagaat
ccggcctctgccgatccgacatccgtgtga
DBGET
integrated database retrieval system