Piscinibacterium candidicorallinum: ACMDW7_16385
Help
Entry
ACMDW7_16385 CDS
T10926
Name
(GenBank) PLP-dependent aminotransferase family protein
KO
K05825
2-aminoadipate transaminase [EC:2.6.1.-]
Organism
pcaz Piscinibacterium candidicorallinum
Pathway
pcaz00300
Lysine biosynthesis
pcaz00630
Glyoxylate and dicarboxylate metabolism
pcaz01100
Metabolic pathways
pcaz01110
Biosynthesis of secondary metabolites
pcaz01210
2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:
pcaz00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
ACMDW7_16385
09105 Amino acid metabolism
00300 Lysine biosynthesis
ACMDW7_16385
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Asp_aminotransf
Motif
Other DBs
NCBI-ProteinID:
XOD96662
LinkDB
All DBs
Position
3627218..3628447
Genome browser
AA seq
409 aa
AA seq
DB search
MNAPLPKSATSTAATTPYVFSQRAQKITSSIIREILKVTERPEVISFAGGLPSPETFPIE
VMKDAFDAVLNTRGKAALQYGPTEGFMPLREWIAADLNAKGARVTAENILLVSGSQQALD
LLGKVLINPGQPVLVETPTYLGALQAFNLFEPSYRSVASDDEGLVPDAITPELREGAAFL
YALPNFQNPTGRTLHEDRRRALVQKAVDLNLLVIEDDPYGDLRYEGQPQPMLLSIAAELG
CENVVRMGSFSKTLAPGLRLGYIAAPKALMNKLVQAKQATDLHTATISQMAVHQVVSSGF
LTEHLPKIRALYKNQCSVMIESLREHLPAGVHFTVPEGGMFLWLTLPEGIDTMKLLDAAV
AANVAFVPGAPFYANEITPNTLRLSFVTVPPEKIRAGVKVLAEVIKKAL
NT seq
1230 nt
NT seq
+upstream
nt +downstream
nt
atgaacgcaccgcttccgaagtccgccacctcgaccgccgccaccacgccctacgtgttc
tcccagcgcgcgcagaagatcaccagctccatcatccgcgagatcctcaaggtcacggag
cggccggaagtgatctcctttgccggcggcctgccctcgcccgagaccttccccatcgag
gtcatgaaggacgcctttgatgccgtgctcaacacacgcggcaaggcggcgctgcagtac
ggcccgaccgaaggcttcatgcccctgcgtgaatggatcgcggccgatctcaatgccaag
ggtgcccgggtcaccgccgagaacatcctgctggtgtccggcagccagcaggcgctcgac
ctgctaggcaaggtgctgatcaaccccggccagccggtgctggtggaaacgcccacctac
ctgggcgcgctgcaggccttcaatctgttcgagccgagctaccgcagcgtggcctcggat
gacgaaggcctggtaccggacgcgatcacgcccgagctgcgcgaaggcgccgccttcctg
tacgccctgcccaatttccagaaccccacgggccgcaccctgcacgaagaccgccgccgc
gccctggtgcagaaggccgtggatctgaacctgctggtgatcgaggacgacccctacggc
gacttgcgctacgaaggccagccccagcccatgctgctgtcgattgccgccgaactcggc
tgtgagaacgtggtgcgcatgggcagcttctccaagaccctggcccccggcctgcgtctg
ggctacatcgccgcgcccaaggcgctcatgaacaagctggtgcaggccaagcaggccacc
gacctgcataccgccaccatcagccagatggctgtgcatcaggtcgtgagcagcggcttt
ctcaccgagcacctgcccaagatccgcgcgctctacaagaaccagtgcagcgtgatgatc
gagagcctgcgcgagcacctgccagcgggtgtgcacttcaccgtgcccgaaggcggcatg
ttcctctggctcaccctgcccgagggcatcgacacgatgaagctgctggacgccgccgtg
gctgcgaatgtggccttcgtgcccggcgcgcccttctacgccaacgagatcacccccaac
accctgcgcctgtcctttgtcaccgtgccgccggagaagatccgcgcgggggtgaaggtg
ctggcggaggtgatcaagaaggcgctgtaa
DBGET
integrated database retrieval system