KEGG   Mixta calida: C2E16_02030
Entry
C2E16_02030       CDS       T05419                                 
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
pcd  Mixta calida
Pathway
pcd00430  Taurine and hypotaurine metabolism
pcd00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:pcd00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    C2E16_02030
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    C2E16_02030
Enzymes [BR:pcd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     C2E16_02030
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AUY23810
UniProt: A0ABM6RXF2
LinkDB
Position
457026..457877
AA seq 283 aa
MNERLTITALGPHIGAQVDNLDLTRPLSDGQFEQLWHALIRHQVLFLRDQPLTPQLQRAL
AARFGDLHIHPVYPHAEGVEEIIVLDTHNDNPPDNDNWHTDVTFIATPPAGAILAAKQVP
EQGGDTLWASGIAAFEALSLPLRSLLSGLNAEHDFTKSFPEYKHRATPEDHARWRQAAAN
HPPLLHPVVRTHPISGKQALFVNEGFTTRIVDLAPKESDALLGFLFAHITKPEFQVRWRW
RANDVAIWDNRVTQHYANADYLPTRRIMHRATVLGDKPFYRAS
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaacgaacgtctgacgattaccgcgctgggcccgcatatcggcgctcaggtggataac
ctcgatcttacccgtccgctcagcgatgggcagtttgaacagctctggcatgcgctgatc
cgccatcaggtgctgtttctgcgcgatcagccgctcacgccgcagctgcagcgggcgctg
gctgcgcgcttcggcgatctgcatattcacccggtttatccgcatgcggagggcgtagag
gaaattatcgtgctggacacgcacaacgataatccgccagataacgataactggcacacc
gatgtcacctttatcgccacgccgcccgccggcgcgattctggcggcgaagcaggtgccg
gagcagggcggcgacaccctgtgggccagcggcatcgccgcgtttgaggcgctgtcgctg
ccgctgcgctcactgctgagcggattgaatgcggagcatgatttcaccaaatccttcccg
gaatataagcatcgcgccacgccggaagatcatgcgcgctggcgtcaggcggcggccaac
catccgccgctgctgcatccggtggtccgcacgcatcccattagcggcaagcaggcgctg
tttgtgaacgagggctttaccacgcgcatcgtcgacctcgcgcccaaagagagcgatgcg
ctgctgggctttctgtttgcccatattactaagccggagtttcaggtgcgctggcgctgg
cgcgctaacgatgtggctatctgggataatcgggtgacgcagcattacgccaacgccgac
tacctgccgacgagacgcattatgcatcgcgccacggtgctgggcgataagcctttttac
cgcgcgtcctga

DBGET integrated database retrieval system