Mixta calida: C2E16_08310 Help Entry C2E16_08310       CDS       T05419                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcd  Mixta calida Pathway pcd01100   Metabolic pathways pcd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2E16_08310    00074 Mycolic acid biosynthesis     C2E16_08310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2E16_08310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH EutQ Ribosomal_L50 DUF6952 Motif Other DBs NCBI-ProteinID:  AUY24911 LinkDB All DBs Position 1762922..1763158 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIISEQLGVKQEEVTNEKSFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINNHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatctccgagcagcttggcgttaagcag gaagaagtcaccaacgaaaaatctttcgttgaagatcttggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcactactgttcaggctgctattgattacatcaataaccatcaggcctaa

DBGET integrated database retrieval system