Mixta calida: C2E16_16080 Help Entry C2E16_16080       CDS       T05419                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism pcd  Mixta calida Brite KEGG Orthology (KO) [BR:pcd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pcd03400]     C2E16_16080 DNA repair and recombination proteins [BR:pcd03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     C2E16_16080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Rnk_N Motif Other DBs NCBI-ProteinID:  AUY26274 LinkDB All DBs Position complement(3374601..3374834) Genome browser AA seq 77 aa AA seqDB search MQVEIMIDKEQKISQATLDALEAELLKNLHPHYPAMAVRIRRSSATSVQLNGLRQDEDKK NVMNILQAVWEDDSWLH NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcaagttgaaatcatgattgataaagagcaaaaaatcagccaggcaacattggacgcg ctggaagctgaattgcttaaaaatttgcacccccactatcccgcaatggctgttcgtatc cgaaggagcagtgcaaccagcgtgcagctgaacggcctgagacaggatgaagataaaaag aacgtaatgaatattcttcaggccgtctgggaagatgacagctggctgcattaa

DBGET integrated database retrieval system