Mixta calida: C2E16_20155 Help Entry C2E16_20155       CDS       T05419                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pcd  Mixta calida Brite KEGG Orthology (KO) [BR:pcd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pcd03110]     C2E16_20155 Chaperones and folding catalysts [BR:pcd03110]  Protein folding catalysts   Protein disulfide isomerase    C2E16_20155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like GST_N SH3BGR Thioredoxin_3 CLIC-like_N Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AUY26967 LinkDB All DBs Position complement(4241832..4242083) Genome browser AA seq 83 aa AA seqDB search MANVEIYTKATCPYCHRAKALLTQKGVAFEEIPIDGDANKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDSRGGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggctaacgtagagatttataccaaagcaacctgcccttattgccaccgggcaaaagcg ctgctgacccagaaaggcgtcgctttcgaggaaatcccgattgacggcgatgcgaacaag cgcgaagagatgatcaagcgcagcggccgtaccaccgtaccgcagatttttatcgatgcg cagcacattggcggctgcgacgatctttacgcgctggacagccgcggagggcttgatcct ctgctgaagtaa

DBGET integrated database retrieval system