Paenibacillus cellulosilyticus: HUB94_03940 Help Entry HUB94_03940       CDS       T07813                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcel  Paenibacillus cellulosilyticus Pathway pcel00998   Biosynthesis of various antibiotics pcel01100   Metabolic pathways pcel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HUB94_03940    00074 Mycolic acid biosynthesis     HUB94_03940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HUB94_03940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QKS43675 LinkDB All DBs Position 220369..220620 Genome browser AA seq 83 aa AA seqDB search MDASSIVLLALSDCCDVYPLEEIHENLRLDELGIDSLRFMELIILLEERAQIEFPDEFLE LSMEKTVRFLIQIIKDEMRNLNK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtggatgcttcgagcatagtcctgttggctttaagcgattgttgtgatgtatacccgtta gaggaaatacacgaaaacctaaggttagacgaattgggcatcgattctttacgtttcatg gaattgatcatcttacttgaagagagagcacagatagagtttccggatgaatttctagag ctctctatggagaagactgttcggtttcttatacaaataattaaagatgagatgagaaat ttaaacaaatag

DBGET integrated database retrieval system