Paenibacillus cellulosilyticus: HUB94_04215 Help Entry HUB94_04215       CDS       T07813                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcel  Paenibacillus cellulosilyticus Pathway pcel00998   Biosynthesis of various antibiotics pcel01100   Metabolic pathways pcel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HUB94_04215    00074 Mycolic acid biosynthesis     HUB94_04215   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HUB94_04215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QKS43727 LinkDB All DBs Position 270067..270315 Genome browser AA seq 82 aa AA seqDB search MIQDLNKFNARLIELAGQLTGEELDMGCLERPLAELNIDSLMLLELAVHLEREYGVRLEE DELTSLRTLSDIATTVADKKRS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgatccaagatttgaataagttcaatgctagactgatagaattggccggtcaattaacg ggcgaggagctggatatgggctgcctggagcgtccgctggcggagttgaacattgattcg ctcatgctgctggaattggccgttcatcttgagcgcgaatacggtgttcggctggaagag gatgaattgacgtctcttcggaccctgtcggatattgcaaccacggtagccgacaagaaa cgttcatga

DBGET integrated database retrieval system