Paenibacillus cellulosilyticus: HUB94_11995 Help Entry HUB94_11995       CDS       T07813                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcel  Paenibacillus cellulosilyticus Pathway pcel00998   Biosynthesis of various antibiotics pcel01100   Metabolic pathways pcel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HUB94_11995    00074 Mycolic acid biosynthesis     HUB94_11995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HUB94_11995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QKS45053 LinkDB All DBs Position 2201031..2201276 Genome browser AA seq 81 aa AA seqDB search MMSRSIEVILRDEIFDEIEIEYPDDHNTNLLDQGIDSAGFIKLIVSIESKFNIAIPDEDL LFENFSTAGLIINYLTAKSIA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgatgtctagatcaattgaagttatcttgagagacgaaatttttgatgagattgaaatc gagtatccagatgatcacaataccaatttgttggatcaagggatcgattcggctggcttc atcaagcttattgtttcaattgaatcgaaatttaacattgcgatccctgatgaggatcta ttgtttgagaacttctccacggctggactaatcattaattatttgaccgcgaaatcgata gcataa

DBGET integrated database retrieval system