Paenibacillus cellulosilyticus: HUB94_18705
Help
Entry
HUB94_18705 CDS
T07813
Name
(GenBank) response regulator
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
pcel
Paenibacillus cellulosilyticus
Pathway
pcel02020
Two-component system
pcel02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
pcel00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
HUB94_18705
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
HUB94_18705
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
pcel02022
]
HUB94_18705
02035 Bacterial motility proteins [BR:
pcel02035
]
HUB94_18705
Two-component system [BR:
pcel02022
]
CheA family
CheA-CheYBV (chemotaxis)
HUB94_18705
Bacterial motility proteins [BR:
pcel02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
HUB94_18705
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Motif
Other DBs
NCBI-ProteinID:
QKS46248
LinkDB
All DBs
Position
complement(3746451..3746813)
Genome browser
AA seq
120 aa
AA seq
DB search
MANRILIVDDAAFMRMMIRDILTKNGYDVVGEAPDGSVAVEKFKELKPDLTTMDITMPEM
DGIAALKEIKKLDPNAKVIMCSAMGQQAMVIDAIQAGAKDFIVKPFQADRVIEAIKKTLG
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atggctaaccgaattctaatcgtagacgacgcagcatttatgcgtatgatgatccgtgat
attttgacgaaaaatgggtacgacgttgtaggggaagcaccggacggctcagttgctgtc
gaaaagttcaaagaactgaagcctgacctgacaacgatggatattacgatgcctgagatg
gacggtatcgctgcactgaaagaaatcaagaagcttgatccgaatgcgaaagtcatcatg
tgttctgcaatgggtcaacaagcgatggttatcgacgctatccaagcaggtgctaaagac
tttatcgtaaagcctttccaagcagatcgcgtaattgaagctatcaagaaaacgctaggt
tag
DBGET
integrated database retrieval system